Creative Strategist

Ramen Bae

📍 Remoteremote
🚀 Apply Now

Job Description

Creative Strategist - Ramen Bae ABOUT RAMEN BAE Ramen Bae is the original dried ramen toppings company on a mission to level up the ramen category. We started three years ago as a passion project because we wanted better instant ramen toppings and couldn’t find anything like it. Since then, we’ve gone viral, built a loyal fan base, grown to over 400,000 customers, and recently launched protein ramen. We’re still just getting started. We’re a small, fast-moving team of builders who take ownership, move quickly, and figure things out as we go. We’re looking for another like-minded person who is excited to help us build the next great ramen brand. ABOUT THE ROLE Ramen Bae is looking for a Creative Strategist to build and lead the creative engine behind our DTC ramen brand. This person will own performance-driven creative across paid social, with Meta currently being our largest channel. You’ll be responsible for understanding our products, customers, audience awareness stages, and performance data, then turning those insights into ad concepts, hooks, scripts, creator briefs, and video assets that convert. This role sits at the intersection of performance marketing, creative strategy, consumer psychology, and execution. The ideal candidate is analytical enough to understand what is working and why, creative enough to find new angles that break through, and scrappy enough to move quickly from idea to launch. This is a high-impact role with significant room for leadership and growth. You’ll work closely with the CMO and growth team to build a repeatable system for producing high-performing creative at scale. RESPONSIBILITIES Creative Strategy • Own creative strategy across paid social and performance marketing channels, with a strong focus on Meta. • Build and manage a repeatable creative testing framework across hooks, formats, scripts, offers, concepts, personas, and audience segments. • Develop creative angles based on customer pain points, product benefits, trends, competitor research, customer reviews, and performance data. • Think through the full customer journey, from problem-unaware audiences to highly aware, ready-to-buy customers. • Own the pipeline of performance video assets, including UGC, creator-led ads, founder-led content, product demos, recipe content, narrative ads, comparison ads, and social-first concepts. • Analyze creative performance to identify winning patterns, scalable concepts, and opportunities for improvement. • Help improve ROAS, CAC, conversion rate, and revenue through stronger creative strategy and execution. Creative Production & Execution • Manage the creative process from concept to brief, scripting, production, editing, feedback, and final delivery. • Write compelling hooks, scripts, ad briefs, and creator directions that are clear, strategic, and performance-oriented. • Direct creators, editors, freelancers, agencies, and internal team members to produce high-performing assets. • Build systems for creative ideation, testing, asset organization, feedback, iteration, and reporting. • Ensure creative is both on-brand and built to perform in paid social environments. • Stay on top of social trends, competitor ads, creator formats, and emerging creative opportunities. • Jump in wherever needed to keep creative moving, whether that means writing scripts, reviewing edits, sourcing creators, organizing assets, or helping bring concepts to life. Strong bonus: Ability to shoot and edit your own creator-style content. REQUIREMENTS <

Listing Intelligence

YouGotJobs keeps this U.S. listing in the public index because it has an active source link, readable role details, and recent freshness signals checked on Jul 9, 2026. No reliable salary range was published with this listing. The role is associated with Remote. Apply details are verified against remoteok.com.

Required Skills

execeducationstrategycustomer supportcopywritingmarketingtravelspeechvideomobilecontent writingseniormedicalsocial mediaecommercefull timedata entrydevweb devmicrosoftopsdigital nomadlegaldesigntechnicalsalesrecruiteradsart directionsaastestingengineerhrsys admincoordinatorpayrollfinanceexceldesignergolang

Free Job Search Tools

This active job listing for Creative Strategist at Ramen Bae in Remote is part of YouGotJobs' verified public job directory.